SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000246080 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000246080
Domain Number 1 Region: 72-128
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-16
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000246080   Gene: ENSG00000125878   Transcript: ENST00000246080
Sequence length 199
Comment pep:known chromosome:GRCh37:20:584441:591042:-1 gene:ENSG00000125878 transcript:ENST00000246080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAG
GGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSY
IAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRD
LGGSCLKVRGVAPLRGPRR
Download sequence
Identical sequences Q12870
9606.ENSP00000246080 ENSP00000246080 ENSP00000246080 ENSP00000246080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]