SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000246912 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000246912
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000246912   Gene: ENSG00000108788   Transcript: ENST00000246912
Sequence length 298
Comment pep:known chromosome:GRCh37:17:40719090:40725257:1 gene:ENSG00000108788 transcript:ENST00000246912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCRED
SSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences H2QD25 Q9UH92
ENSP00000246912 NP_733752.1.87134 NP_733752.1.92137 XP_001163625.1.37143 XP_003813943.1.60992 ENSP00000246912 ENSP00000246912 9598.ENSPTRP00000015681 9606.ENSP00000246912 ENSPTRP00000015681 ENSGGOP00000010596 ENSGGOP00000010596 gi|24586667|ref|NP_733752.1| ENSPTRP00000015681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]