SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000247153 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000247153
Domain Number 1 Region: 257-308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000235
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 137-186
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000654
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 189-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 4 Region: 77-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 311-371
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 376-415
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000602
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000247153   Gene: ENSG00000126759   Transcript: ENST00000247153
Sequence length 469
Comment pep:known chromosome:GRCh37:X:47483613:47489704:-1 gene:ENSG00000126759 transcript:ENST00000247153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNT
AFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTL
EWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQE
SEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPG
LAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDA
TRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRC
AGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL
Download sequence
Identical sequences A0A0S2Z4I5 P27918
ENSP00000247153 ENSP00000380189 ENSP00000247153 NP_001138724.1.87134 NP_001138724.1.92137 NP_002612.1.87134 NP_002612.1.92137 9606.ENSP00000247153 ENSP00000247153 ENSP00000380189 gi|223671861|ref|NP_001138724.1| gi|4505737|ref|NP_002612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]