SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000247470 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000247470
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 2e-23
Family Pyrin domain, PYD 0.00000742
Further Details:      
 
Domain Number 2 Region: 109-193
Classification Level Classification E-value
Superfamily DEATH domain 2.43e-18
Family Caspase recruitment domain, CARD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000247470   Gene: ENSG00000103490   Transcript: ENST00000247470
Sequence length 195
Comment pep:known chromosome:GRCh37:16:31212806:31214313:-1 gene:ENSG00000103490 transcript:ENST00000247470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS
Download sequence
Identical sequences G3RLS4 Q9ULZ3
NP_037390.2.87134 NP_037390.2.92137 XP_004057599.1.27298 HR4443 ENSP00000247470 ENSGGOP00000016734 ENSP00000247470 ENSGGOP00000016734 ENSP00000247470 gi|10835256|ref|NP_037390.2| 9606.ENSP00000247470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]