SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000250076 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000250076
Domain Number 1 Region: 71-159
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.28e-37
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 289-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000250076   Gene: ENSG00000167840   Transcript: ENST00000250076
Sequence length 444
Comment pep:known chromosome:GRCh37:17:5008930:5026397:-1 gene:ENSG00000167840 transcript:ENST00000250076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGPVRGPLQDSSWYEPSAELVQTRMAVSLTAAETLALQGTQGQEKMMMMGPKEEEQS
CEYETRLPGNHSTSQEIFRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILE
FLVLEQFLTILPEELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQVPGPAHGPAQEEPW
EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEV
ESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGK
KDHECSECGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFE
CNECGKAFRWGAHLVQHQRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKEC
GKAYGWCSELIRHRRVHARKEPSH
Download sequence
Identical sequences ENSP00000250076 gi|37574601|ref|NP_055334.2| 9606.ENSP00000250076 ENSP00000250076 NP_055334.2.87134 NP_055334.2.92137 XP_016880510.1.92137 ENSP00000250076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]