SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000251775 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000251775
Domain Number 1 Region: 59-186
Classification Level Classification E-value
Superfamily PX domain 4.84e-27
Family PX domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSP00000251775
Domain Number - Region: 229-342
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00282
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000251775   Gene: ENSG00000114520   Transcript: ENST00000251775
Sequence length 450
Comment pep:known chromosome:GRCh37:3:125165495:125239041:-1 gene:ENSG00000114520 transcript:ENST00000251775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVY
YPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLF
LTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRV
RARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTT
KLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE
ALISYAVMQISMCKKGIQVWTNAKECFSKM
Download sequence
Identical sequences H2QN95 O95219
ENSP00000251775 ENSP00000251775 NP_003785.1.87134 NP_003785.1.92137 XP_001169563.2.37143 9598.ENSPTRP00000026413 9606.ENSP00000251775 ENSPTRP00000026413 gi|4507145|ref|NP_003785.1| GO.36851 HR4477 hsi002014878.1 ENSPTRP00000026413 ENSP00000251775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]