SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000252463 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000252463
Domain Number 1 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.2e-21
Family SCAN domain 0.0002
Further Details:      
 
Domain Number 3 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 668-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-16
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 292-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000438
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 422-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00001
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Weak hits

Sequence:  ENSP00000252463
Domain Number - Region: 377-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0139
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000252463   Gene: ENSG00000130182   Transcript: ENST00000252463
Sequence length 725
Comment pep:known chromosome:GRCh37:16:3138891:3142861:-1 gene:ENSG00000130182 transcript:ENST00000252463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRASLSRLRELCGHWLRPALHTKKQILELLVLEQFLSVLPPHLLGRLQGQPLRDGEEV
VLLLEGIHREPSHAGPLDFSCNAGKSCPRADVTLEEKGCASQVPSHSPKKELPAEEPSVL
GPSDEPPRPQPRAAQPAEPGQWRLPPSSKQPLSPGPQKTFQALQESSPQGPSPWPEESSR
DQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD
SPGVPGEPCAQSLGRGAAASGPGEDGSLLGSSEILEVKVAEGVPEPNPELQFICADCGVS
FPQLSRLKAHQLRSHPAGRSFLCLCCGKSFGRSSILKLHMRTHTDERPHACHLCGHRFRQ
SSHLSKHLLTHSSEPAFLCAECGRGFQRRASLVQHLLAHAQDQKPPCAPESKAEAPPLTD
VLCSHCGQSFQRRSSLKRHLRIHARDKDRRSSEGSGSRRRDSDRRPFVCSDCGKAFRRSE
HLVAHRRVHTGERPFSCQACGRSFTQSSQLVSHQRVHTGEKPYACPQCGKRFVRRASLAR
HLLTHGGPRPHHCTQCGKSFGQTQDLARHQRSHTGEKPCRCSECGEGFSQSAHLARHQRI
HTGEKPHACDTCGHRFRNSSNLARHRRSHTGERPYSCQTCGRSFRRNAHLRRHLATHAEP
GQEQAEPPQECVECGKSFSRSCNLLRHLLVHTGARPYSCTQCGRSFSRNSHLLRHLRTHA
RETLY
Download sequence
Identical sequences Q96SZ4
GO.81843 ENSP00000252463 9606.ENSP00000252463 ENSP00000252463 ENSP00000252463 gi|14249488|ref|NP_116194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]