SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000252771 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000252771
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-56
Family FCH domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000252771   Gene: ENSG00000130475   Transcript: ENST00000252771
Sequence length 889
Comment pep:known chromosome:GRCh37:19:17858527:17899377:1 gene:ENSG00000130475 transcript:ENST00000252771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYFGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASN
GTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVST
LDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQKEMDKAETKTKKAAESLRRSVE
KYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNI
ENVSVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEAMKRLRGAKAFRLPGLSRRERE
PEPPAAVDFLEPDSGTCPEVDEEGFTVRPDVTQNSTAEPSRFSSSDSDFDDEEPRKFYVH
IKPAPARAPACSPEAAAAQLRATAGSLILPPGPGGTMKRHSSRDAAGKPQRPRSAPRTSS
CAERLQSEEQVSKNLFGPPLESAFDHEDFTGSSSLGFTSSPSPFSSSSPENVEDSGLDSP
SHAAPGPSPDSWVPRPGTPQSPPSCRAPPPEARGIRAPPLPDSPQPLASSPGPWGLEALA
GGDLMPAPADPTAREGLAAPPRRLRSRKVSCPLTRSNGDLSRSLSPSPLGSSAASTALER
PSFLSQTGHGVSRGPSPVVLGSQDALPIATAFTEYVHAYFRGHSPSCLARVTGELTMTFP
AGIVRVFSGTPPPPVLSFRLVHTTAIEHFQPNADLLFSDPSQSDPETKDFWLNMAALTEA
LQRQAEQNPTASYYNVVLLRYQFSRPGPQSVPLQLSAHWQCGATLTQVSVEYGYRPGATA
VPTPLTNVQILLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGRLSASWEPLS
GPSTPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATGMYLVSC
Download sequence
Identical sequences O14526
ENSP00000252771 gi|239049457|ref|NP_001154830.1| gi|29789054|ref|NP_055937.1| NP_001154830.1.87134 NP_001154830.1.92137 NP_055937.1.87134 NP_055937.1.92137 XP_006722764.1.92137 XP_006722765.1.92137 XP_011526126.1.92137 XP_011526127.1.92137 XP_011526128.1.92137 XP_011526130.1.92137 XP_016882008.1.92137 XP_016882009.1.92137 XP_016882010.1.92137 ENSP00000252771 ENSP00000373785 ENSP00000437978 ENSP00000470493 ENSP00000470731 ENSP00000472417 9606.ENSP00000252771 ENSP00000252771 ENSP00000470493 ENSP00000470731 ENSP00000472417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]