SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000254165 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000254165
Domain Number 1 Region: 36-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.88e-28
Family SCAN domain 0.00024
Further Details:      
 
Domain Number 2 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 355-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000254165   Gene: ENSG00000131848   Transcript: ENST00000254165
Sequence length 496
Comment pep:known chromosome:GRCh37:19:56732856:56826294:-1 gene:ENSG00000131848 transcript:ENST00000254165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANCTSSWSLGESCNRPGLELPRSMASSETQLGNHDVDPEISHVNFRMFSCPKESDPIQ
ALRKLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVMMNGVQSCKDLEDLLR
NNRRPKKWSVVTFHGKEYIVQDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAH
RELQILPRVPALSRRQGEDFLLHKSIDVTGDPKSLRPKQTLEKDLKENREENPGLTSPEP
QLPKSPTDLVRAKEGKDPPKIASVENVDADTPSACVVEREASTHSGNRGDALNLSSPKRS
KPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEAKALPPFACDV
CEKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVCQKQ
FTQKSYLKCHKRSHTGEKPFECKDCKKVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRL
KLLRRHQKTHPEATSQ
Download sequence
Identical sequences A0A024R4S6 Q9BUG6
ENSP00000254165 ENSP00000375593 ENSP00000467631 NP_001308993.1.87134 NP_001308993.1.92137 NP_001308994.1.87134 NP_001308994.1.92137 NP_001308995.1.87134 NP_001308995.1.92137 NP_001308996.1.87134 NP_001308996.1.92137 NP_001308997.1.87134 NP_001308997.1.92137 NP_001308998.1.87134 NP_001308998.1.92137 NP_001308999.1.87134 NP_001308999.1.92137 NP_001309001.1.87134 NP_001309001.1.92137 NP_077279.1.87134 NP_077279.1.92137 gi|13236532|ref|NP_077279.1| ENSP00000375593 ENSP00000467631 9606.ENSP00000254165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]