SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000254528 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000254528
Domain Number 1 Region: 906-1048
Classification Level Classification E-value
Superfamily TNF-like 2.65e-26
Family TNF-like 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSP00000254528
Domain Number - Region: 651-734
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00949
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 178-332
Classification Level Classification E-value
Superfamily Tropomyosin 0.0203
Family Tropomyosin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000254528   Gene: ENSG00000132205   Transcript: ENST00000254528
Sequence length 1053
Comment pep:known chromosome:GRCh37:18:2847028:2915991:1 gene:ENSG00000132205 transcript:ENST00000254528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQPRRPWPRVPWRWALALLALVGAGLCHAGPQPGYPARPSARNKNWCAYIVNKNVSCSV
LEGSESFIQAQYNCAWNQMPCPSALVYRVNFRPRYVTRYKTVTQLEWRCCPGFRGGDCQE
GPKDPVKTLRPTPARPRNSLKKATDNEPSQFSEPRKTLSPTGTAQPSWGVDPKEGPQELQ
EKKIQVLEEKVLRLTRTVLDLQSSLAGVSENLKHATQDDASRTRAPGLSSQHPKPDTTVS
GDTETGQSPGVFNTKESGMKDIKSELAEVKDTLKNKSDKLEELDGKVKGYEGQLRQLQEA
AQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLTGLQQQCDDYGS
SYLGVIELIGEKETSLRKEINNLRARLQEPSAQANCCDSEKNGDIGQQIKTLDQKIERVA
EATRMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAIN
GEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNTGAELSPPGAAALPGVSGSGDERVMMELN
HLKDKVQVVEDICLLNIQGKPHGMEGALPNREDRAVRDSLHLLKSLNDTMHRKFQETEQT
IQKLQQDFSFLYSQLNHTENDVTHLQKEMSNCRAGENAGMGRFTKVGEQERTVDTLPSPQ
HPVAHCCSQLEERWQRLQSQVISELDACKECTQGVQREVSMVEGRVSHMEKTCSKLDSIS
GNLQRIKEGLNKHVSSLWNCVRQMNGTLRSHSRDISGLKNSVQQFYSHVFQISTDLQDLV
KFQPSAKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERPPQPPG
STGVIAETGQAGPPAGAGVSGRGLPRGVDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGA
PVPSLVSFSAGLTQKPFPSDGGVVLFNKVLVNDGDVYNPSTGVFTAPYDGRYLITATLTP
ERDAYVEAVLSVSNASVAQLHTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAV
NVVVTGGKLAHTDFDEMYSTFSGVFLYPFLSHL
Download sequence
Identical sequences Q9BXX0
NP_114437.2.87134 NP_114437.2.92137 9606.ENSP00000254528 ENSP00000254528 ENSP00000254528 gi|60498978|ref|NP_114437.2| ENSP00000254528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]