SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000256257 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000256257
Domain Number 1 Region: 92-140
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-20
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Weak hits

Sequence:  ENSP00000256257
Domain Number - Region: 19-59
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.043
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000256257   Gene: ENSG00000133874   Transcript: ENST00000256257
Sequence length 155
Comment pep:known chromosome:GRCh37:8:33405273:33424643:-1 gene:ENSG00000133874 transcript:ENST00000256257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFI
SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCL
VKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV
Download sequence
Identical sequences H2R9V3 Q9H9V4
ENSP00000256257 NP_079063.2.87134 NP_079063.2.92137 XP_001169238.1.37143 XP_003830796.1.60992 ENSPTRP00000053203 9598.ENSPTRP00000053203 9606.ENSP00000256257 ENSP00000256257 gi|38045931|ref|NP_079063.2| ENSP00000256257 ENSPTRP00000053203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]