SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000257359 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000257359
Domain Number 1 Region: 216-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-50
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 525-580
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000275
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 834-887
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000257359   Gene: ENSG00000134917   Transcript: ENST00000257359
Sequence length 889
Comment pep:known chromosome:GRCh37:11:130274820:130298888:-1 gene:ENSG00000134917 transcript:ENST00000257359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAPAAPRWPPLLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAF
GKGFVLRLAPDDSFLAPEFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCR
GLSGSFLLDGEEFTIQPQGAGGSLAQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERG
DHQEDSEEESQEEEAEGASEPPPPLGATSRTKRFVSEARFVETLLVADASMAAFYGADLQ
NHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGPEVSDNGGLTLRNFCNWQRRF
NQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIEDEGLQAAHT
LAHELGHVLSMPHDDSKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGG
HGDCLLDAPAAALPLPTGLPGRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTD
GAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSR
TCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
TDMDGNLLQWVPKYAGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPETLAICVRGQ
CVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKVSGSLTPTNYGYNDIVTIPAGATNIDVKQ
RSHPGVQNDGNYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIATLERLQSFR
PLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGD
WSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL
Download sequence
Identical sequences Q9UP79
NP_008968.4.87134 NP_008968.4.92137 ENSP00000257359 9606.ENSP00000257359 ENSP00000257359 ENSP00000257359 gi|153792351|ref|NP_008968.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]