SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000257552 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000257552
Domain Number 1 Region: 98-206
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-28
Family Canonical RBD 0.0000141
Further Details:      
 
Domain Number 2 Region: 16-104
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.2e-25
Family Canonical RBD 0.000012
Further Details:      
 
Weak hits

Sequence:  ENSP00000257552
Domain Number - Region: 227-281
Classification Level Classification E-value
Superfamily ApbE-like 0.0445
Family DVU1097-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000257552   Gene: ENSG00000135097   Transcript: ENST00000257552
Sequence length 362
Comment pep:known chromosome:GRCh37:12:120779133:120806983:-1 gene:ENSG00000135097 transcript:ENST00000257552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE
CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH
Download sequence
Identical sequences A0A2I3SD00 A0A2J8XK50 A0A2K5DCH9 A0A2K5LF81 A0A2K5S4I2 A0A2K6DCC8 A0A2K6FCD5 A2PYH9 F7GG14 O43347
ENSP00000257552 ENSCJAP00000015866 9606.ENSP00000257552 NP_001074996.1.59421 NP_001074996.1.76553 NP_002433.1.87134 NP_002433.1.92137 XP_002753122.1.60252 XP_004281472.1.21590 XP_004396726.1.74151 XP_004664194.1.11716 XP_008003127.1.81039 XP_009003007.1.60252 XP_009003008.1.60252 XP_011536663.1.92137 XP_011761813.1.29376 XP_011926508.1.92194 XP_011967766.1.54773 XP_012505658.1.63892 XP_012612123.1.48125 XP_013375820.1.28644 XP_013375821.1.28644 XP_016779867.1.37143 XP_017365722.1.71028 XP_017365723.1.71028 XP_017916620.1.57651 XP_019322816.1.44245 XP_019322817.1.44245 XP_020034662.1.5219 XP_020138620.1.48125 XP_021487429.1.76796 XP_021531157.1.9421 gi|4505255|ref|NP_002433.1| ENSP00000257552 ENSP00000257552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]