SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000257901 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000257901
Domain Number 1 Region: 352-429
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.59e-22
Family Intermediate filament protein, coiled coil region 0.00067
Further Details:      
 
Domain Number 2 Region: 122-156
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000251
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000257901
Domain Number - Region: 159-230
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000628
Family Intermediate filament protein, coiled coil region 0.0083
Further Details:      
 
Domain Number - Region: 284-376
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00562
Family Typo IV secretion system protein TraC 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000257901   Gene: ENSG00000135443   Transcript: ENST00000257901
Sequence length 507
Comment pep:known chromosome:GRCh37:12:52753790:52761265:-1 gene:ENSG00000135443 transcript:ENST00000257901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCRSYRISSGCGVTRNFSSCSAVAPKTGNRCCISAAPYRGVSCYRGLTGFGSRSLCNLG
SCGPRIAVGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVK
QEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKWQFYQNQRCCESNLEPLFSGYIETLR
REAECVEADSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVVLKKDVDCAYLRKS
DLEANVEALVEESSFLRRLYEEEIRVLQAHISDTSVIVKMDNSRDLNMDCIIAEIKAQYD
DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEIENAKCQR
AKLEAAVAEAEQQGEAALSDARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDIEI
ATYRRLLEGEEHRLCEGVGSVNVCVSSSRGGVSCGGLSYSTTPGRQITSGPSAIGGSITV
VAPDSCAPCQPRSSSFSCGSSRSVRFA
Download sequence
Identical sequences P78386
gi|4504935|ref|NP_002274.1| NP_002274.1.87134 NP_002274.1.92137 ENSP00000257901 ENSP00000257901 9606.ENSP00000257901 ENSP00000257901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]