SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 69_37 > ENSP00000257974

Domain assignment for ENSP00000257974 from Homo sapiens 69_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000257974
Domain Number 1	Region: 349-426
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	6.98e-22
Family	Intermediate filament protein, coiled coil region	0.00074
Further Details:

Domain Number 2	Region: 119-153
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	0.0000000000785
Family	Intermediate filament protein, coiled coil region	0.0018
Further Details:

Domain Number 3	Region: 156-227
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	0.0000162
Family	Intermediate filament protein, coiled coil region	0.009
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000257974 Gene: ENSG00000161850 Transcript: ENST00000257974
Sequence length	513
Comment	pep:known chromosome:GRCh37:12:52787715:52800139:-1 gene:ENSG00000161850 transcript:ENST00000257974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNV GFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDE KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQL DCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLE TNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIA SRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKL EGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATY RRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGEL YVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH
Download sequence
Identical sequences	Q9NSB4 ENSP00000257974 ENSP00000257974 gi\|27477127\|ref\|NP_149022.3\| NP_149022.3.87134 NP_149022.3.92137 ENSP00000257974 9606.ENSP00000257974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]