SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000258821 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000258821
Domain Number 1 Region: 91-140,168-274
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000402
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000258821
Domain Number - Region: 8-94
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0547
Family Spectrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000258821   Gene: ENSG00000136319   Transcript: ENST00000258821
Sequence length 440
Comment pep:known chromosome:GRCh37:14:20754387:20774153:-1 gene:ENSG00000136319 transcript:ENST00000258821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMADEEEEVKPILQKLQELVDQLYSFRDCYFETHSVEDAGRKQQDVQKEMEKTLQQMEEV
VGSVQGKAQVLMLTGKALNVTPDYSPKAEELLSKAVKLEPELVEAWNQLGEVYWKKGDVA
AAHTCFSGALTHCRNKVSLQNLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGR
SWYILGNSYLSLYFSTGQNPKISQQALSAYAQAEKVDRKASSNPDLHLNRATLHKYEESY
GEALEGFSRAAALDPAWPEPRQREQQLLEFLDRLTSLLESKGKVKTKKLQSMLGSLRPAH
LGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEKVPFTFGLVDS
DGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNG
KPQGSSSQAVATVASRPQCE
Download sequence
Identical sequences Q8N0Z6
9606.ENSP00000258821 ENSP00000258821 ENSP00000258821 gi|226498382|ref|NP_612385.2| ENSP00000258821 NP_612385.2.87134 NP_612385.2.92137 XP_003811766.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]