SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000259526 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000259526
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000549
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 102-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000324
Family Fibronectin type I module 0.044
Further Details:      
 
Domain Number 3 Region: 206-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000259526   Gene: ENSG00000136999   Transcript: ENST00000259526
Sequence length 357
Comment pep:known chromosome:GRCh37:8:120428546:120436593:1 gene:ENSG00000136999 transcript:ENST00000259526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDG
CSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Download sequence
Identical sequences A0A024R9J4 P48745
ENSP00000259526 ENSP00000259526 9606.ENSP00000259526 gi|4505423|ref|NP_002505.1| NYSGXRC-13056a NP_002505.1.87134 NP_002505.1.92137 ENSP00000259526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]