SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261862 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261862
Domain Number 1 Region: 855-912
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000916
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 679-736
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 737-793
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 916-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000129
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 53-95
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 797-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 626-676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000589
Family TSP-1 type 1 repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261862   Gene: ENSG00000187720   Transcript: ENST00000261862
Sequence length 1018
Comment pep:known chromosome:GRCh37:15:71433788:72075722:1 gene:ENSG00000187720 transcript:ENST00000261862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSHFMGSLSVLCFLLLLGFQFVCPQPSTQHRKVPQRMAAEGAPEDDGGGGAPGVWGAWG
PWSACSRSCSGGVMEQTRPCLPRSYRLRGGQRPGAPARAFADHVVSAVRTSVPLHRSRDE
TPALAGTDASRQGPTVLRGSRHPQPQGLEVTGDRRSRTRGTIGPGKYGYGKAPYILPLQT
DTAHTPQRLRRQKLSSRHSRSQGASSARHGYSSPAHQVPQHGPLYQSDSGPRSGLQAAEA
PIYQLPLTHDQGYPAASSLFHSPETSNNHGVGTHGATQSFSQPARSTAISCIGAYRQYKL
CNTNVCPESSRSIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQAMGYRFYVRQ
AEKVIDGTPCDQNGTAICVSGQCKSIGCDDYLGSDKVVDKCGVCGGDNTGCQVVSGVFKH
ALTSLGYHRVVEIPEGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGT
MFTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPH
RRPGEPFNGQMVTEGRSQEEGEQKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPH
RPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDS
SMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQ
HLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKL
RPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPA
EATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEK
PPSQQSCHLKPCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEERE
SCNPQDCVPEVDENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRQTGFLGSR
Download sequence
Identical sequences Q6ZMP0
ENSP00000261862 ENSP00000347484 ENSP00000261862 ENSP00000347484 gi|94536854|ref|NP_079093.2| NP_079093.2.87134 NP_079093.2.92137 XP_006720755.1.92137 9606.ENSP00000261862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]