SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261918 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261918
Domain Number 1 Region: 65-496
Classification Level Classification E-value
Superfamily Sema domain 1.31e-112
Family Sema domain 0.00000176
Further Details:      
 
Domain Number 2 Region: 493-529
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000075
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 545-621
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000762
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261918   Gene: ENSG00000138623   Transcript: ENST00000261918
Sequence length 666
Comment pep:known chromosome:GRCh37:15:74701630:74726808:-1 gene:ENSG00000138623 transcript:ENST00000261918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSC
LDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLV
LFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKI
YYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNF
NRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPN
PRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVS
SQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKE
CPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFI
ENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLT
LGLLVH
Download sequence
Identical sequences O75326
NYSGRC-IgSF-SEM7A_HUMAN ENSP00000261918 NP_003603.1.87134 NP_003603.1.92137 ENSP00000261918 gi|4504237|ref|NP_003603.1| 9606.ENSP00000261918 ENSP00000261918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]