SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262435 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262435
Domain Number 1 Region: 379-741
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.49e-128
Family Hect, E3 ligase catalytic domain 0.00000000354
Further Details:      
 
Domain Number 2 Region: 12-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-23
Family PLC-like (P variant) 0.041
Further Details:      
 
Domain Number 3 Region: 291-331
Classification Level Classification E-value
Superfamily WW domain 0.000000000000428
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 153-192
Classification Level Classification E-value
Superfamily WW domain 0.0000000000147
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 245-286
Classification Level Classification E-value
Superfamily WW domain 0.00000000025
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262435   Gene: ENSG00000108854   Transcript: ENST00000262435
Sequence length 748
Comment pep:known chromosome:GRCh37:17:62541483:62658186:-1 gene:ENSG00000108854 transcript:ENST00000262435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE
Download sequence
Identical sequences A0A2J8UZX9 K7CBS9 Q9HAU4
ENSPTRP00000016213 ENSP00000262435 ENSP00000461327 gi|12232397|ref|NP_073576.1| ENSPTRP00000016213 ENSP00000262435 NP_073576.1.87134 NP_073576.1.92137 ENSP00000262435 ENSP00000461327 9606.ENSP00000262435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]