SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262891 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262891
Domain Number 1 Region: 56-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-96
Family Protein kinases, catalytic subunit 0.0000113
Further Details:      
 
Domain Number 2 Region: 639-752
Classification Level Classification E-value
Superfamily KA1-like 7.52e-33
Family Kinase associated domain 1, KA1 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSP00000262891
Domain Number - Region: 321-372
Classification Level Classification E-value
Superfamily UBA-like 0.00175
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262891   Gene: ENSG00000007047   Transcript: ENST00000262891
Sequence length 752
Comment pep:known chromosome:GRCh37:19:45754516:45806951:1 gene:ENSG00000007047 transcript:ENST00000262891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL
Download sequence
Identical sequences Q96L34
ENSP00000262891 gi|315467849|ref|NP_001186796.1| NP_001186796.1.87134 NP_001186796.1.92137 ENSP00000262891 ENSP00000262891 HR3532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]