SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262903 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262903
Domain Number 1 Region: 547-902
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.67e-119
Family Hect, E3 ligase catalytic domain 0.0000000743
Further Details:      
 
Domain Number 2 Region: 33-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.03e-57
Family Ankyrin repeat 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSP00000262903
Domain Number - Region: 248-329,485-518
Classification Level Classification E-value
Superfamily ARM repeat 0.0959
Family Clathrin adaptor core protein 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262903   Gene: ENSG00000085382   Transcript: ENST00000262903
Sequence length 909
Comment pep:known chromosome:GRCh37:6:105175968:105307794:-1 gene:ENSG00000085382 transcript:ENST00000262903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYA
FGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEY
SADVNICNNEGLTAIHWLAVNGRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTV
QCLLDSGADINRPNVSGATPLYFACSHGQRDTAQILLLRGAKYLPDKNGVTPLDLCVQGG
YGETCEVLIQYHPRLFQTIIQMTQNEDLRENMLRQVLEHLSQQSESQYLKILTSLAEVAT
TNGHKLLSLSSNYDAQMKSLLRIVRMFCHVFRIGPSSPSNGIDMGYNGNKTPRSQVFKPL
ELLWHSLDEWLVLIATELMKNKRDSTEITSILLKQKGQDQDAASIPPFEPPGPGSYENLS
TGTRESKPDALAGRQEASADCQDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFV
CKHDEVLKCFVNRNPKIIFDHFHFLLECPELMSRFMHIIKAQPFKDRCEWFYEHLHSGQP
DSDMVHRPVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREW
FDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI
YFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEE
VPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYE
LELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSR
VPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALH
CGSYGYTMA
Download sequence
Identical sequences H2PJX3 Q8IYU2
HR6100 ENSPPYP00000018892 ENSP00000262903 9600.ENSPPYP00000018892 9606.ENSP00000262903 ENSP00000262903 ENSP00000262903 gi|116875852|ref|NP_065822.2| NP_065822.2.87134 NP_065822.2.92137 XP_002817239.1.23681 XP_003824397.1.60992 ENSPPYP00000018892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]