SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000263966 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000263966
Domain Number 1 Region: 331-504,544-629,658-686,754-861
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.26e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00065
Further Details:      
 
Domain Number 2 Region: 188-295
Classification Level Classification E-value
Superfamily RING/U-box 6.95e-33
Family Zf-UBP 0.00000447
Further Details:      
 
Domain Number 3 Region: 723-769
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000681
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000263966   Gene: ENSG00000058056   Transcript: ENST00000263966
Sequence length 863
Comment pep:known chromosome:GRCh37:3:179370543:179507189:1 gene:ENSG00000058056 transcript:ENST00000263966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIP
FSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFG
ASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS
Download sequence
Identical sequences A0A0A6YZ17 Q92995
9606.ENSP00000263966 NP_003931.2.87134 NP_003931.2.92137 ENSP00000263966 gi|215598688|ref|NP_003931.2| ENSP00000263966 ENSP00000263966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]