SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000264033 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264033
Domain Number 1 Region: 49-177
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.62e-58
Family N-terminal domain of cbl (N-cbl) 0.000000168
Further Details:      
 
Domain Number 2 Region: 264-350
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 356-434
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 178-263
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 843-893
Classification Level Classification E-value
Superfamily UBA-like 0.00000689
Family UBA domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264033   Gene: ENSG00000110395   Transcript: ENST00000264033
Sequence length 906
Comment pep:known chromosome:GRCh37:11:119076752:119177651:1 gene:ENSG00000110395 transcript:ENST00000264033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT
Download sequence
Identical sequences H2Q4Y2 P22681
ENSP00000264033 ENSP00000264033 NP_005179.2.87134 NP_005179.2.92137 XP_001165648.1.37143 ENSP00000264033 ENSPTRP00000007497 gi|52426745|ref|NP_005179.2| 9598.ENSPTRP00000007497 9606.ENSP00000264033 ENSPTRP00000007497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]