SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000264343 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264343
Domain Number 1 Region: 128-329
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 18-124
Classification Level Classification E-value
Superfamily PH domain-like 9.51e-33
Family Pleckstrin-homology domain (PH domain) 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSP00000264343
Domain Number - Region: 645-735
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000628
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264343   Gene: ENSG00000138639   Transcript: ENST00000264343
Sequence length 748
Comment pep:known chromosome:GRCh37:4:86851426:86923821:1 gene:ENSG00000138639 transcript:ENST00000264343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL
GTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSI
RRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQA
NLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSK
EEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPK
VEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQN
KENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNG
TVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFS
MMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDD
LSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKI
EYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQK
EMEQFFSTFGELTVEPRRTERGNTIWIQ
Download sequence
Identical sequences Q8N264
9606.ENSP00000315334 NP_001020787.2.87134 NP_001020787.2.92137 gi|111154092|ref|NP_001020787.2| ENSP00000378611 ENSP00000378611 ENSP00000264343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]