SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000265036 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265036
Domain Number 1 Region: 14-124
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.83e-24
Family DEP domain 0.013
Further Details:      
 
Domain Number 2 Region: 219-392
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-16
Family BCR-homology GTPase activation domain (BH-domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265036   Gene: ENSG00000035499   Transcript: ENST00000265036
Sequence length 529
Comment pep:known chromosome:GRCh37:5:59892739:59995988:-1 gene:ENSG00000035499 transcript:ENST00000265036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCS
QNFGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPP
NQKDVIKFPEWNDLPPGTSQENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEA
NVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELP
HWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYGHLKEPLLTFHLFDAFVSVLG
LLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGFGTRTLMVQTF
SRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKS
YPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM
Download sequence
Identical sequences Q8WUY9
9606.ENSP00000265036 ENSP00000265036 gi|223633999|ref|NP_060839.2| NP_060839.2.87134 NP_060839.2.92137 ENSP00000265036 ENSP00000265036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]