SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000266068 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000266068
Domain Number 1 Region: 89-176
Classification Level Classification E-value
Superfamily SAND domain-like 4.19e-30
Family SAND domain 0.00000974
Further Details:      
 
Weak hits

Sequence:  ENSP00000266068
Domain Number - Region: 248-344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0561
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000266068   Gene: ENSG00000101216   Transcript: ENST00000266068
Sequence length 530
Comment pep:known chromosome:GRCh37:20:62218955:62251229:-1 gene:ENSG00000101216 transcript:ENST00000266068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAA
AAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGL
KDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPR
LARATSGPAAMASQVLTQSAQLALGPGVPVPQLTSVPLGKVVSTLPSTVLGKGSLQAPPA
SSPASPLLGGYTVLASSGSTYPSTVEIHPDASSLTVLSTAAVQDGSTVFKVVSPLQLLTL
PGLGPTLQNVAQASPGSSTIVTVPAGAAPGPEEHTATIEVAAMAEDHERK
Download sequence
Identical sequences Q9UKD1
ENSP00000266068 ENSP00000359094 9606.ENSP00000266068 ENSP00000266068 GO.34896 NP_036516.1.87134 NP_036516.1.92137 XP_005260259.1.92137 ENSP00000266068 ENSP00000359094 gi|6912568|ref|NP_036516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]