SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000271015 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000271015
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily DEATH domain 4.66e-21
Family Caspase recruitment domain, CARD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000271015   Gene: ENSG00000142867   Transcript: ENST00000271015
Sequence length 233
Comment pep:known chromosome:GRCh37:1:85731931:85743771:-1 gene:ENSG00000142867 transcript:ENST00000271015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ
Download sequence
Identical sequences K7BBV8 O95999
ENSGGOP00000011801 ENSPTRP00000001578 gi|4502379|ref|NP_003912.1| ENSPTRP00000001578 9598.ENSPTRP00000001578 9606.ENSP00000271015 ENSP00000359612 ENSGGOP00000011801 NP_003912.1.87134 NP_003912.1.92137 XP_003805343.1.60992 XP_004026114.1.27298 XP_513526.2.37143 ENSP00000271015 ENSP00000359612 GO.37160 HR6417 NYSGXRC-13040a O95999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]