SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000271588 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000271588
Domain Number 1 Region: 4870-5085
Classification Level Classification E-value
Superfamily GFP-like 9.42e-62
Family Domain G2 of nidogen-1 0.00078
Further Details:      
 
Domain Number 2 Region: 2474-2573
Classification Level Classification E-value
Superfamily Immunoglobulin 6.91e-26
Family I set domains 0.0091
Further Details:      
 
Domain Number 3 Region: 1164-1261
Classification Level Classification E-value
Superfamily Immunoglobulin 9.11e-25
Family I set domains 0.0084
Further Details:      
 
Domain Number 4 Region: 3241-3342
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-24
Family I set domains 0.005
Further Details:      
 
Domain Number 5 Region: 2393-2481
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-24
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 4074-4171
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-24
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 3051-3153
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-24
Family I set domains 0.0085
Further Details:      
 
Domain Number 8 Region: 3627-3719
Classification Level Classification E-value
Superfamily Immunoglobulin 5.68e-24
Family I set domains 0.0059
Further Details:      
 
Domain Number 9 Region: 2582-2669
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 10 Region: 2879-2967
Classification Level Classification E-value
Superfamily Immunoglobulin 4.13e-23
Family I set domains 0.0063
Further Details:      
 
Domain Number 11 Region: 3979-4078
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-23
Family I set domains 0.033
Further Details:      
 
Domain Number 12 Region: 2962-3058
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-23
Family I set domains 0.0061
Further Details:      
 
Domain Number 13 Region: 2680-2768
Classification Level Classification E-value
Superfamily Immunoglobulin 8.64e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 14 Region: 603-700
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-23
Family I set domains 0.02
Further Details:      
 
Domain Number 15 Region: 2286-2387
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 16 Region: 4347-4446
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-22
Family I set domains 0.0096
Further Details:      
 
Domain Number 17 Region: 3708-3806
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 3902-3994
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 19 Region: 2789-2871
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 1086-1177
Classification Level Classification E-value
Superfamily Immunoglobulin 7.78e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 1821-1920
Classification Level Classification E-value
Superfamily Immunoglobulin 7.86e-22
Family I set domains 0.0094
Further Details:      
 
Domain Number 22 Region: 786-885
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 3146-3246
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 24 Region: 1447-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-21
Family I set domains 0.025
Further Details:      
 
Domain Number 25 Region: 4164-4262
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 26 Region: 3800-3899
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 27 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 2.97e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 28 Region: 1542-1641
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-21
Family I set domains 0.0046
Further Details:      
 
Domain Number 29 Region: 889-983
Classification Level Classification E-value
Superfamily Immunoglobulin 3.94e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 30 Region: 1366-1455
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 31 Region: 2102-2197
Classification Level Classification E-value
Superfamily Immunoglobulin 7.67e-21
Family I set domains 0.009
Further Details:      
 
Domain Number 32 Region: 4250-4348
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 33 Region: 3443-3529
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 34 Region: 2008-2107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 35 Region: 3535-3622
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 36 Region: 1745-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 37 Region: 4433-4527
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 38 Region: 1929-2014
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 39 Region: 1278-1361
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-19
Family I set domains 0.0046
Further Details:      
 
Domain Number 40 Region: 518-617
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.053
Further Details:      
 
Domain Number 41 Region: 3352-3435
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 42 Region: 1634-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-19
Family I set domains 0.0044
Further Details:      
 
Domain Number 43 Region: 2191-2292
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-18
Family I set domains 0.0079
Further Details:      
 
Domain Number 44 Region: 981-1074
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-17
Family I set domains 0.0092
Further Details:      
 
Domain Number 45 Region: 701-799
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 46 Region: 5091-5236
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 47 Region: 4639-4697
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000012
Family TSP-1 type 1 repeat 0.00016
Further Details:      
 
Domain Number 48 Region: 4582-4640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000706
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 49 Region: 4527-4583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000011
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 50 Region: 4811-4868
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 51 Region: 4697-4754
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000011
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 52 Region: 4753-4811
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000131
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 53 Region: 5233-5354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000014
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 54 Region: 5411-5527
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 55 Region: 445-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000144
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000271588   Gene: ENSG00000143341   Transcript: ENST00000271588
Sequence length 5635
Comment pep:known chromosome:GRCh37:1:185703683:186160081:1 gene:ENSG00000143341 transcript:ENST00000271588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWEVVHTVFLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPMIEIRNPLGKLIKKGFGLHELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYPHRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSS
VSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYLKESA
SVNLDIAKVTLSDEGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERAVLT
CLIISAVDYNLTWQRNDRDVRLAEPARIRTLANLSLELKSVKFNDAGEYHCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDMFIVGSHRYRM
TSDGTLFIKNAAPKDAGIYGCLASNSAGTDKQNSTLRYIEAPKLMVVQSELLVALGDITV
MECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGR
ATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFS
VSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVAN
VIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIERVQLQDGGEYTC
VASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGNPKPSVIWSKKGEL
ISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNTAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITET
RTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLP
VITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQE
PPTVEDLEPPYNTTFQERVANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGISILEDG
TLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNL
FCEVEGTPSPIIMWYKDNVQVTESSTIQTVNNGKILKLFRATPEDAGRYSCKAINIAGTS
QKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPN
VELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVL
INSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYTCHV
ANVAGTAEKSFHVDVYVPPMIEGNLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGV
PVKANDNIRIEAGGKKLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDE
TSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSNT
GLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITW
LKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPS
LEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIES
AQISDAGIYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPA
PSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRV
YVPPNIMGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLLKKPGLSISENRSVLK
IEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCES
SGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKK
EYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPLIKAKGVE
ILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVE
KNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVR
NAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPL
QEDEAHHIISGGRFLQITNVQVPHTGRYTCLASSPAGHKSRSFSLNVFVSPTIAGVGSDG
NPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDN
AGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYA
IPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDV
NIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTS
SDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPE
EVTVLVNKSALIECLSSGSPAPRNSWQKDGQPLLEDDHHKFLSNGRILQILNTQITDIGR
YVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLK
NEQPIKLNTNTLIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKD
HDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQMLHIKKA
EVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPP
PTIAWLKNHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLS
IQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSAN
GSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTLVDTSI
NIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAG
VDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDA
HLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHINGSEEHEEISV
IVNNPLELTCIASGIPAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCL
ASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGE
RLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQ
SLVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGR
YLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKN
GHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIA
DEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLN
HAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFIT
WQKEGINVNTSGRNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPV
ISPHLKEYVIAVDKPITLSCEADGLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQP
GDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAI
NWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLP
TFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSK
EDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPT
IQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPP
IITLEPVETVINAGGKIILNCQATGEPQPTITWSRQGHSISWDDRVNVLSNNSLYIADAQ
KEDTSEFECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPL
PANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQH
GGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGS
YCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCE
GSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPD
SQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGRPCPGDTTQV
TRCNVQACPGGPQRARGSVIGNINDVEFGIAFLNATITDSPNSDTRIIRAKITNVPRSLG
SAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEILQMSHIARGLDS
DGSLLLDIVVSGYVLQLQSPAEVTVKDYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWN
HTVFYDQAQGRMPFLVETLHASSVESDYNQIEETLGFKIHASISKGDRSNQCPSGFTLDS
VGPFCADEDECAAGNPCSHSCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTCHA
GQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQESSPCHQRCFNAIGSFHCGCEPG
YQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGT
HQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDINECEQVPKPCAHQCSNTPGSFKCI
CPPGQHLLGDGKSCAGLERLPNYGTQYSSYNLARFSPVRNNYQPQQHYRQYSHLYSSYSE
YRNSRTSLSRTRRTIRKTCPEGSEASHDTCVDIDECENTDACQHECKNTFGSYQCICPPG
YQLTHNGKTCQDIDECLEQNVHCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNC
PPNDLECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQDGVMHPRTTFLMVDEEQTVPF
ALRDENLKGVVYTTRPLREAETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences Q96RW7
ENSP00000271588 gi|118572606|ref|NP_114141.2| ENSP00000271588 NYSGRC-IgSF-HMCN1_HUMAN ENSP00000271588 NP_114141.2.87134 NP_114141.2.92137 9606.ENSP00000271588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]