SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000274181 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000274181
Domain Number 1 Region: 288-493
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.89e-54
Family Reprolysin-like 0.00044
Further Details:      
 
Domain Number 2 Region: 583-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.06e-16
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 1128-1177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000119
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 921-986
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 989-1047
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 1054-1114
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSP00000274181
Domain Number - Region: 879-927
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0432
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000274181   Gene: ENSG00000145536   Transcript: ENST00000274181
Sequence length 1224
Comment pep:known chromosome:GRCh37:5:5140443:5320417:1 gene:ENSG00000145536 transcript:ENST00000274181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRARGWRGLAALWMLLAQVAEQAPACAMGPAAAAPGSPSVPRPPPPAERPGWMEKGEY
DLVSAYEVDHRGDYVSHEIMHHQRRRRAVPVSEVESLHLRLKGSRHDFHMDLRTSSSLVA
PGFIVQTLGKTGTKSVQTLPPEDFCFYQGSLRSHRNSSVALSTCQGLSGMIRTEEADYFL
RPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHSSDLRL
GLPQKQHFCGRRKKYMPQPPKEDLFILPDEYKSCLRHKRSLLRSHRNEELNVETLVVVDK
KMMQNHGHENITTYVLTILNMVSALFKDGTIGGNINIAIVGLILLEDEQPGLVISHHADH
TLSSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYRSCTIN
EDTGLGLAFTIAHESGHNFGMIHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSPCSRQYLH
KFLSTAQAICLADQPKPVKEYKYPEKLPGELYDANTQCKWQFGEKAKLCMLDFKKDICKA
LWCHRIGRKCETKFMPAAEGTICGHDMWCRGGQCVKYGDEGPKPTHGHWSDWSSWSPCSR
TCGGGVSHRSRLCTNPKPSHGGKFCEGSTRTLKLCNSQKCPRDSVDFRAAQCAEHNSRRF
RGRHYKWKPYTQVEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDGICERV
GCDNVLGSDAVEDVCGVCNGNNSACTIHRGLYTKHHHTNQYYHMVTIPSGARSIRIYEMN
VSTSYISVRNALRRYYLNGHWTVDWPGRYKFSGTTFDYRRSYNEPENLIATGPTNETLIV
ELLFQGRNPGVAWEYSMPRLGTEKQPPAQPSYTWAIVRSECSVSCGGGQMTVREGCYRDL
KFQVNMSFCNPKTRPVTGLVPCKVSACPPSWSVGNWSACSRTCGGGAQSRPVQCTRRVHY
DSEPVPASLCPQPAPSSRQACNSQSCPPAWSAGPWAECSHTCGKGWRKRAVACKSTNPSA
RAQLLPDAVCTSEPKPRMHEACLLQRCHKPKKLQWLVSAWSQCSVTCERGTQKRFLKCAE
KYVSGKYRELASKKCSHLPKPSLELERACAPLPCPRHPPFAAAGPSRGSWFASPWSQCTA
SCGGGVQTRSVQCLAGGRPASGCLLHQKPSASLACNTHFCPIAEKKDAFCKDYFHWCYLV
PQHGMCSHKFYGKQCCKTCSKSNL
Download sequence
Identical sequences Q8TE57
ENSP00000274181 NP_620687.2.87134 NP_620687.2.92137 9606.ENSP00000274181 NYSGRC-110735441 gi|110735441|ref|NP_620687.2| ENSP00000274181 ENSP00000274181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]