SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000274255 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000274255
Domain Number 1 Region: 157-395
Classification Level Classification E-value
Superfamily RNI-like 2.35e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.000000000675
Further Details:      
 
Domain Number 2 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 3.53e-16
Family F-box domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000274255   Gene: ENSG00000145604   Transcript: ENST00000274255
Sequence length 424
Comment pep:known chromosome:GRCh37:5:36152169:36184421:1 gene:ENSG00000145604 transcript:ENST00000274255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL
Download sequence
Identical sequences A0A024R069 A0A2I3RFB4 Q13309
ENSP00000274255 gi|16306595|ref|NP_005974.2| ENSPTRP00000028804 ENSP00000274255 NP_005974.2.87134 NP_005974.2.92137 XP_003806703.1.60992 XP_526948.2.37143 ENSP00000274255 ENSPTRP00000028804 9606.ENSP00000274255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]