SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000276211 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000276211
Domain Number 1 Region: 231-426
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.51e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000276211   Gene: ENSG00000147256   Transcript: ENST00000276211
Sequence length 547
Comment pep:known chromosome:GRCh37:X:130192216:130223853:1 gene:ENSG00000147256 transcript:ENST00000276211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCIPFLKAARALCPRIMPPLLLLSAFIFLVSVLGGAPGHNPDRRTKMVSIHSLSELER
LKLQETAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEV
LVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSRRRNEPTLPREFT
RRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVE
ACCQFIEKHGLSAVGIFTLEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRD
MKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLLKALHKITENCED
SIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHYVASVNVVRAMID
NWDVLFQVPPHIQRQVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSA
EARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRPLLRVPREKEAKT
GVSYFFP
Download sequence
Identical sequences Q6ZRI8
NP_659404.2.87134 NP_659404.2.92137 9606.ENSP00000276211 gi|40255080|ref|NP_659404.2| ENSP00000276211 ENSP00000276211 ENSP00000276211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]