SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000276416 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000276416
Domain Number 1 Region: 15-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.27e-50
Family BAR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000276416   Gene: ENSG00000147439   Transcript: ENST00000276416
Sequence length 253
Comment pep:known chromosome:GRCh37:8:22477931:22526633:-1 gene:ENSG00000147439 transcript:ENST00000276416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAV
KISLDLLSNPLCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPS
LNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLL
EEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAK
LSELRALSIVADD
Download sequence
Identical sequences G3QJ12 H2RDE5 Q9NQY0
ENSPTRP00000058722 9606.ENSP00000276416 ENSP00000276416 ENSGGOP00000002390 NP_061158.1.87134 NP_061158.1.92137 XP_003311686.1.37143 XP_003823641.1.60992 XP_004046806.1.27298 gi|8923904|ref|NP_061158.1| ENSPTRP00000058722 ENSP00000276416 ENSP00000276416 ENSGGOP00000002390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]