SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000277462 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000277462
Domain Number 1 Region: 216-370
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.29e-58
Family Glutathione S-transferase (GST), C-terminal domain 0.0000000487
Further Details:      
 
Domain Number 2 Region: 101-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.84e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000277462   Gene: ENSG00000148334   Transcript: ENST00000277462
Sequence length 377
Comment pep:known chromosome:GRCh37:9:130883105:130890674:-1 gene:ENSG00000148334 transcript:ENST00000277462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
Download sequence
Identical sequences G2HJX9 Q9H7Z7
9598.ENSPTRP00000041523 9606.ENSP00000345341 HR6816 ENSP00000345341 ENSPTRP00000041523 ENSP00000277462 NP_001233456.1.37143 NP_079348.1.87134 NP_079348.1.92137 XP_016817240.1.37143 ENSP00000345341 ENSPTRP00000041523 gi|13376617|ref|NP_079348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]