SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000281419 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000281419
Domain Number 1 Region: 542-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-67
Family Ankyrin repeat 0.0000000435
Further Details:      
 
Domain Number 2 Region: 32-270,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.44e-67
Family BAR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 420-538
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.000000744
Further Details:      
 
Domain Number 4 Region: 301-409
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 929-1004
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000281419   Gene: ENSG00000151693   Transcript: ENST00000281419
Sequence length 1006
Comment pep:known chromosome:GRCh37:2:9346894:9545807:1 gene:ENSG00000151693 transcript:ENST00000281419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
Download sequence
Identical sequences O43150
gi|4502249|ref|NP_003878.1| ENSP00000281419 ENSP00000281419 NP_003878.1.87134 NP_003878.1.92137 9606.ENSP00000281419 ENSP00000281419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]