SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000284984 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000284984
Domain Number 1 Region: 255-466
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-53
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 557-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000109
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 905-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000876
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 856-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000284984   Gene: ENSG00000154734   Transcript: ENST00000284984
Sequence length 967
Comment pep:known chromosome:GRCh37:21:28208606:28217728:-1 gene:ENSG00000154734 transcript:ENST00000284984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS
Download sequence
Identical sequences Q9UHI8
ENSP00000284984 gi|50845384|ref|NP_008919.3| ENSP00000284984 ENSP00000284984 9606.ENSP00000284984 NP_008919.3.87134 NP_008919.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]