SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000286657 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000286657
Domain Number 1 Region: 256-458
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.45e-47
Family Reprolysin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 550-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 969-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 908-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 846-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000641
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000286657   Gene: ENSG00000156140   Transcript: ENST00000286657
Sequence length 1205
Comment pep:known chromosome:GRCh37:4:73146686:73434516:-1 gene:ENSG00000156140 transcript:ENST00000286657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHT
LSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQLVAPGAVVEWHETSLVPGNI
TDPINNHQPGSATYRIRRTEPLQTNCAYVGDIVDIPGTSVAISNCDGLAGMIKSDNEEYF
IEPLERGKQMEEEKGRIHVVYKRSAVEQAPIDMSKDFHYRESDLEGLDDLGTVYGNIHQQ
LNETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
INVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHHDHAIFLTRQD
FGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETA
MGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFDHDWPKLPELPGINYSMDE
QCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHC
MWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLC
NTEECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDPKKRCHLYCQSKETGDVAYM
KQLVHDGTHCSYKDPYSICVRGECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFT
RTPRKLGYLKMFDIPPGARHVLIQEDEASPHILAIKNQATGHYILNGKGEEAKSRTFIDL
GVEWDYNIEDDIESLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPTINSNNVI
QEELDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCN
IQECTHPLWVAEEWEHCTKTCGSSGYQLRTVRCLQPLLDGTNRSVHSKYCMGDRPESRRP
CNRVPCPAQWKTGPWSECSVTCGEGTEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPC
LGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSSTLPPPYLLEAAETHDDVISNPSDLP
RSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGANLRQRSAQQAGSK
TVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIIDNRRPTRS
STLER
Download sequence
Identical sequences O15072
ENSP00000286657 ENSP00000480055 9606.ENSP00000286657 NP_055058.2.87134 NP_055058.2.92137 gi|333360873|ref|NP_055058.2| ENSP00000286657 ENSP00000286657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]