SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000286744 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000286744
Domain Number 1 Region: 1309-1386
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-18
Family I set domains 0.0093
Further Details:      
 
Domain Number 2 Region: 923-996
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000013
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 706-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 1204-1284
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000224
Family I set domains 0.037
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 1425-1483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 10 Region: 759-819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 815-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 12 Region: 1477-1544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000124
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 13 Region: 1599-1655
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000118
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 647-703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000746
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000286744   Gene: ENSG00000156218   Transcript: ENST00000286744
Sequence length 1691
Comment pep:known chromosome:GRCh37:15:84322838:84708594:1 gene:ENSG00000156218 transcript:ENST00000286744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWTSPWWVLIGMVFMHSPLPQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTRSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYNDVQYQGHYYEWLPRYNDPAAPCALKCHAQGQNLVVELAPKV
LDGTRCNTDSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFLVENTTVEFQR
GSERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEK
SPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFTQT
ETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATC
VGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG
VGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQ
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQ
RRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILS
VQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLG
ITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDH
SEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQF
EAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQPTHMQWRG
IQEETPPAAQLRGETGSVSQSSHAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGN
TVYITKRTEVINILCDLITPSEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGI
YECSVANHLGSDVESSSVLYAEAPVILSVERNITKPEHNHLSVVVGGIVEAALGANVTIR
CPVKGVPQPNITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATS
VLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATC
GHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCG
EGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGNRCPGRCMGR
AVRMQQRHTACQHNSSDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGRGFQSR
KVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRY
KQRCCQSCQEG
Download sequence
Identical sequences P82987
ENSP00000286744 gi|145275198|ref|NP_997400.2| NP_997400.2.87134 NP_997400.2.92137 9606.ENSP00000286744 ENSP00000286744 ENSP00000286744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]