SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000288087 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000288087
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily HAD-like 5.34e-24
Family Magnesium-dependent phosphatase-1, Mdp1 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000288087   Gene: ENSG00000213920   Transcript: ENST00000288087
Sequence length 176
Comment pep:known chromosome:GRCh37:14:24683143:24685273:-1 gene:ENSG00000213920 transcript:ENST00000288087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQS
LGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIF
FDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Download sequence
Identical sequences Q86V88
ENSP00000288087 9606.ENSP00000288087 ENSP00000288087 gi|33457311|ref|NP_612485.2| NP_612485.2.87134 NP_612485.2.92137 ENSP00000288087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]