SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000289968 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000289968
Domain Number 1 Region: 6-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.33e-59
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 249-442
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000289968   Gene: ENSG00000140750   Transcript: ENST00000289968
Sequence length 881
Comment pep:known chromosome:GRCh37:16:24930706:25026652:-1 gene:ENSG00000140750 transcript:ENST00000289968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT
DAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIV
DPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEM
DEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAH
QDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLK
AALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDL
WRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMA
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERK
RPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTVVPAGP
EPPPQSSRAESSSGGGTVPSSAGILEQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASG
QNQPQAAAGSHQLSMGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTS
QHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPT
QATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLA
GGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDS
NSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL
Download sequence
Identical sequences Q68EM7
ENSP00000289968 9606.ENSP00000289968 ENSP00000289968 NP_001006635.1.87134 NP_001006635.1.92137 gi|54860079|ref|NP_001006635.1| ENSP00000289968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]