SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000291552 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000291552
Domain Number 1 Region: 76-150
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.04e-18
Family Splicing factor U2AF subunits 0.00000382
Further Details:      
 
Weak hits

Sequence:  ENSP00000291552
Domain Number - Region: 16-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000392
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 150-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000581
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000291552   Gene: ENSG00000160201   Transcript: ENST00000291552
Sequence length 240
Comment pep:known chromosome:GRCh37:21:44513066:44527697:-1 gene:ENSG00000160201 transcript:ENST00000291552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ
SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
Download sequence
Identical sequences A0A0D9R6L7 A0A1U7UA65 A0A2I3LT65 A0A2J8UB35 A0A2K5D629 A0A2K5P5M0 A0A2K5SCT6 A0A2K5V1N3 A0A2K6BKM2 G3U6Z5 J9P492 K7CGB8 P0DN76 Q01081 U3F2J1
ENSCAFP00000015559 ENSTSYP00000006257 gi|5803207|ref|NP_006749.1| ENSLAFP00000023603 9598.ENSPTRP00000024015 9606.ENSP00000291552 ENSMMUP00000029977 NP_001307575.1.87134 NP_001307575.1.92137 NP_006749.1.92137 XP_001118538.2.72884 XP_001137466.2.37143 XP_003419077.1.64505 XP_003640134.1.84170 XP_004406636.1.74151 XP_005548644.1.63531 XP_006870878.1.41390 XP_006893999.1.29581 XP_007945452.1.48129 XP_007967567.1.81039 XP_008069164.1.4292 XP_008143896.1.99482 XP_010381469.1.97406 XP_011724239.1.29376 XP_011892777.1.92194 XP_012300262.1.9421 XP_012916783.1.14098 XP_015998970.1.101085 XP_016802692.1.37143 XP_017394048.1.71028 XP_017727536.1.44346 XP_019288237.1.44245 XP_019521580.1.44202 XP_020140268.1.48125 XP_021534820.1.83697 ENSTSYP00000006257 ENSP00000291552 ENSMMUP00000003198 ENSCAFP00000040371 ENSP00000291552 ENSP00000291552 ENSP00000485022 ENSLAFP00000009573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]