SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000293670 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000293670
Domain Number 1 Region: 340-417
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.8e-21
Family Intermediate filament protein, coiled coil region 0.00059
Further Details:      
 
Domain Number 2 Region: 110-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000319
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 3 Region: 8-106,427-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000011
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000293670
Domain Number - Region: 234-340
Classification Level Classification E-value
Superfamily Prefoldin 0.00068
Family Prefoldin 0.011
Further Details:      
 
Domain Number - Region: 148-218
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000994
Family Intermediate filament protein, coiled coil region 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000293670   Gene: ENSG00000170523   Transcript: ENST00000293670
Sequence length 493
Comment pep:known chromosome:GRCh37:12:52708085:52715182:-1 gene:ENSG00000170523 transcript:ENST00000293670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFR
AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNS
RFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFAGYIETLRREAECVEADSGR
LASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQE
IDFLRRLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES
WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQ
QGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQ
RLCEGVEAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNLVVSTGLCKPCGQLN
TTCGGGSCGQGRH
Download sequence
Identical sequences P78385
NP_002273.3.87134 NP_002273.3.92137 gi|169790841|ref|NP_002273.3| ENSP00000293670 9606.ENSP00000293670 ENSP00000293670 ENSP00000293670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]