SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000295133 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000295133
Domain Number 1 Region: 618-697
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000379
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 712-886
Classification Level Classification E-value
Superfamily RNI-like 0.000000255
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000295133   Gene: ENSG00000163013   Transcript: ENST00000295133
Sequence length 936
Comment pep:known chromosome:GRCh37:2:73481810:73498043:-1 gene:ENSG00000163013 transcript:ENST00000295133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTGLSDQQVVCDLDHRAVEALLQAVRKRMAGASPAVPHERARLTGGAAAVEPACRGGGG
AMASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAAAAAA
AASGFPLAPEPAALLAVPGARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFP
GDLVPASLPCEELAEPGLVPAAAARYALREIEIPLGELFARKSVASSACSTPPPGPGPGP
CPGPASASPASPSPADVAYEEGLARLKIRALEKLEVDRRLERLSEEVEQKIAGQVGRLQA
ELERKAAELETARQESARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQELSR
KQQEVVQIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSCGSTPSASLG
RGGGGGGAGPNARGPGRMREHHVGPAVPNTYAVSRHGSSPSTGASSRVPAASQSSGCYDS
DSLELPRPEEGAPEDSGPGGLGTRAQAANGGSERSQPPRSSGLRRQAIQNWQRRPRRHST
EGEEGDVSDVGSRTTESEAEGPLDAPRPGPAMAGPLSSCRLSARPEGGSGRGRRAERVSP
SRSNEVISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARV
CSKFLAMLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNL
LILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVA
PLHPCQQPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVS
EITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPS
SPEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGGC
Download sequence
Identical sequences ENSP00000295133 9606.ENSP00000295133 ENSP00000295133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]