SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000295899 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000295899
Domain Number - Region: 48-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0439
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000295899   Gene: ENSG00000163634   Transcript: ENST00000295899
Sequence length 204
Comment pep:known chromosome:GRCh37:3:63819546:63849579:-1 gene:ENSG00000163634 transcript:ENST00000295899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQC
EFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYD
ALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQT
LENDEKLSEVEEAQEASMETDPKP
Download sequence
Identical sequences A0A024R332 A0A2J8TEH5 A0A2K6ND57 G1RM39 K7BYA8 Q3SZ60 Q6I9Y2
ENSP00000295899 9606.ENSP00000295899 9913.ENSBTAP00000012008 ENSNLEP00000024276 GO.46693 NP_001035604.1.59421 NP_001035604.1.76553 NP_079351.2.87134 NP_079351.2.92137 XP_003273705.1.23891 XP_003811649.1.60992 XP_005217641.1.76553 XP_010351203.1.97406 XP_010984677.1.51371 XP_011976102.1.54773 XP_014957827.1.66739 XP_016796945.1.37143 XP_017922615.1.57651 XP_019833604.1.53367 ENSP00000295899 ENSBTAP00000012008 ENSBTAP00000012008 gi|156151381|ref|NP_079351.2| ENSP00000295899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]