SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000296098 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296098
Domain Number 1 Region: 119-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000366
Family B-box zinc-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000942
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSP00000296098
Domain Number - Region: 224-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0191
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296098   Gene: ENSG00000138100   Transcript: ENST00000296098
Sequence length 400
Comment pep:known chromosome:GRCh37:2:27505330:27530307:1 gene:ENSG00000138100 transcript:ENST00000296098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKKQDLTLLPR
LECSGTNTTYCSLDLPSSSDPPILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEV
CQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLE
ASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEH
VAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP
Download sequence
Identical sequences A0A2I3T965
ENSPTRP00000020204 ENSP00000296098 ENSP00000296098 9598.ENSPTRP00000020204 9606.ENSP00000296098 gi|78482627|ref|NP_115935.3| NP_115935.3.87134 NP_115935.3.92137 ENSP00000296098 ENSPTRP00000020204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]