SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000298097 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000298097
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000157
Family F-box domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSP00000298097
Domain Number - Region: 197-355
Classification Level Classification E-value
Superfamily RNI-like 0.00104
Family 28-residue LRR 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000298097   Gene: ENSG00000165355   Transcript: ENST00000298097
Sequence length 555
Comment pep:known chromosome:GRCh37:14:39866873:39901704:-1 gene:ENSG00000165355 transcript:ENST00000298097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLSVPQPRPPGARTRAGAARVARWRRLRLQQLRRLRGLLRVLRGRPGAGSRRRGRMA
LCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPA
EQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGPGDGGGADTGTGGEEVEALQLSARWLE
VLRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQ
LFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAV
ELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHW
KALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDK
FLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
RGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEP
NRHFYREMQSFSEDI
Download sequence
Identical sequences Q7Z6M2
ENSP00000298097 NP_976046.1.87134 NP_976046.1.92137 9606.ENSP00000298097 ENSP00000298097 ENSP00000298097 NYSGRC-42558258 gi|42558258|ref|NP_976046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]