SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000299164 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299164
Domain Number 1 Region: 215-426
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.98e-54
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 514-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000955
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 890-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000968
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 4 Region: 839-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000628
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299164   Gene: ENSG00000166106   Transcript: ENST00000299164
Sequence length 950
Comment pep:known chromosome:GRCh37:11:130318869:130346532:1 gene:ENSG00000166106 transcript:ENST00000299164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFSTEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
QTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRVDGSWAKWDPYGPCSRTCGGGVQLAR
RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
ARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
AWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC
Download sequence
Identical sequences Q8TE58
MPIB-423 NP_620686.1.87134 NP_620686.1.92137 9606.ENSP00000299164 ENSP00000299164 ENSP00000299164 ENSP00000299164 gi|21265058|ref|NP_620686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]