SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000302895 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000302895
Domain Number 1 Region: 1124-1300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-573
Classification Level Classification E-value
Superfamily PH domain-like 2.25e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 4 Region: 878-1039
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 1434-1570
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-17
Family SAM (sterile alpha motif) domain 0.0000256
Further Details:      
 
Domain Number 7 Region: 585-685
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000283
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 8 Region: 1016-1110
Classification Level Classification E-value
Superfamily PH domain-like 0.000000225
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000302895   Gene: ENSG00000047365   Transcript: ENST00000303965
Sequence length 1704
Comment pep:known chromosome:GRCh37:4:36067620:36246131:-1 gene:ENSG00000047365 transcript:ENST00000303965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQL
ETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIES
LITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS
PPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGVS
GSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQGE
ALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLY
QAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSMKFYRGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYDIWPPAGKERKRSITKNPKIG
GLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERASMVAHCLEHKD
DKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI
EELNVVLQRSRTLPKELQDEQILK
Download sequence
Identical sequences Q8WZ64
ENSP00000302895 ENSP00000302895 ENSP00000302895 NP_056045.2.87134 NP_056045.2.92137 XP_016863188.1.92137 9606.ENSP00000302895 gi|21264592|ref|NP_056045.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]