SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000303212 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000303212
Domain Number 1 Region: 30-522
Classification Level Classification E-value
Superfamily Sema domain 1.83e-177
Family Sema domain 0.0000000000522
Further Details:      
 
Domain Number 2 Region: 518-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000227
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 591-672
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000152
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000303212   Gene: ENSG00000170381   Transcript: ENST00000307792
Sequence length 775
Comment pep:known chromosome:GRCh37:7:82993222:83278326:-1 gene:ENSG00000170381 transcript:ENST00000307792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFHSPFGFLDLHT
MLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVR
VLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFIS
TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDRD
DNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMN
GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPRHTLDS
Download sequence
Identical sequences O15041
9606.ENSP00000303212 ENSP00000303212 gi|6912650|ref|NP_036563.1| ENSP00000303212 NYSGRC-IgSF-SEM3E_HUMAN NP_036563.1.87134 NP_036563.1.92137 ENSP00000303212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]