SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000305263 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000305263
Domain Number 1 Region: 318-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.28e-21
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 84-118
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000523
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSP00000305263
Domain Number - Region: 130-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000305263   Gene: ENSG00000173908   Transcript: ENST00000306658
Sequence length 464
Comment pep:known chromosome:GRCh37:17:38948455:38956211:-1 gene:ENSG00000173908 transcript:ENST00000306658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGS
HAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKG
WYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYE
NELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAG
GNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT
FARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLH
QVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLS
KTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
Download sequence
Identical sequences Q7Z3Y7
9606.ENSP00000305263 NP_853513.2.87134 NP_853513.2.92137 ENSP00000305263 ENSP00000305263 gi|114431246|ref|NP_853513.2| ENSP00000305263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]